Protein Description: ADP-ribosylation factor-like 3
Gene Name: ARL3
Alternative Gene Name: ARFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025035: 100%, ENSRNOG00000019973: 97%
Entrez Gene ID: 403
Uniprot ID: P36405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARL3
Alternative Gene Name: ARFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025035: 100%, ENSRNOG00000019973: 97%
Entrez Gene ID: 403
Uniprot ID: P36405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALT |
| Documents & Links for Anti ARL3 pAb (ATL-HPA063596) | |
| Datasheet | Anti ARL3 pAb (ATL-HPA063596) Datasheet (External Link) |
| Vendor Page | Anti ARL3 pAb (ATL-HPA063596) at Atlas |
| Documents & Links for Anti ARL3 pAb (ATL-HPA063596) | |
| Datasheet | Anti ARL3 pAb (ATL-HPA063596) Datasheet (External Link) |
| Vendor Page | Anti ARL3 pAb (ATL-HPA063596) |