Protein Description: ADP-ribosylation factor-like 15
Gene Name: ARL15
Alternative Gene Name: ARFRP2, FLJ20051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042348: 98%, ENSRNOG00000011105: 98%
Entrez Gene ID: 54622
Uniprot ID: Q9NXU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARL15
Alternative Gene Name: ARFRP2, FLJ20051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042348: 98%, ENSRNOG00000011105: 98%
Entrez Gene ID: 54622
Uniprot ID: Q9NXU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM |
| Documents & Links for Anti ARL15 pAb (ATL-HPA063820) | |
| Datasheet | Anti ARL15 pAb (ATL-HPA063820) Datasheet (External Link) |
| Vendor Page | Anti ARL15 pAb (ATL-HPA063820) at Atlas |
| Documents & Links for Anti ARL15 pAb (ATL-HPA063820) | |
| Datasheet | Anti ARL15 pAb (ATL-HPA063820) Datasheet (External Link) |
| Vendor Page | Anti ARL15 pAb (ATL-HPA063820) |
| Citations for Anti ARL15 pAb (ATL-HPA063820) – 1 Found |
| Wu, Yixing; Bai, Ying; McEwan, David G; Bentley, Liz; Aravani, Dimitra; Cox, Roger D. Palmitoylated small GTPase ARL15 is translocated within Golgi network during adipogenesis. Biology Open. 2021;10(12) PubMed |