![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101038/181075/atl-hpa073012_anti-arl1-pab-atl-hpa073012_62743__14606.1681137317.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
Protein Description: ADP-ribosylation factor-like 1
Gene Name: ARL1
Alternative Gene Name: ARFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060904: 100%, ENSRNOG00000005763: 100%
Entrez Gene ID: 400
Uniprot ID: P40616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARL1
Alternative Gene Name: ARFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060904: 100%, ENSRNOG00000005763: 100%
Entrez Gene ID: 400
Uniprot ID: P40616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ |
| Documents & Links for Anti ARL1 pAb (ATL-HPA073012) | |
| Datasheet | Anti ARL1 pAb (ATL-HPA073012) Datasheet (External Link) |
| Vendor Page | Anti ARL1 pAb (ATL-HPA073012) at Atlas |
| Documents & Links for Anti ARL1 pAb (ATL-HPA073012) | |
| Datasheet | Anti ARL1 pAb (ATL-HPA073012) Datasheet (External Link) |
| Vendor Page | Anti ARL1 pAb (ATL-HPA073012) |