Anti ARIH1 pAb (ATL-HPA073245)

Atlas Antibodies

Catalog No: ATL-HPA073245-25

• 

Product Description

Protein Description: ariadne RBR E3 ubiquitin protein ligase 1
Gene Name: ARIH1
Alternative Gene Name: ARI, HARI, HHARI, UBCH7BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025234: 100%, ENSRNOG00000009887: 100%
Entrez Gene ID: 25820
Uniprot ID: Q9Y4X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN
• Gene Sequence: NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN
• Gene ID - Mouse: ENSMUSG00000025234
• Gene ID - Rat: ENSRNOG00000009887
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.