Protein Description: ariadne RBR E3 ubiquitin protein ligase 1
Gene Name: ARIH1
Alternative Gene Name: ARI, HARI, HHARI, UBCH7BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025234: 100%, ENSRNOG00000009887: 100%
Entrez Gene ID: 25820
Uniprot ID: Q9Y4X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARIH1
Alternative Gene Name: ARI, HARI, HHARI, UBCH7BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025234: 100%, ENSRNOG00000009887: 100%
Entrez Gene ID: 25820
Uniprot ID: Q9Y4X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN |
| Documents & Links for Anti ARIH1 pAb (ATL-HPA073245) | |
| Datasheet | Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link) |
| Vendor Page | Anti ARIH1 pAb (ATL-HPA073245) at Atlas |
| Documents & Links for Anti ARIH1 pAb (ATL-HPA073245) | |
| Datasheet | Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link) |
| Vendor Page | Anti ARIH1 pAb (ATL-HPA073245) |