Anti ARHGEF19 pAb (ATL-HPA068108)

Atlas Antibodies

Catalog No: ATL-HPA068108-25

• 

Product Description

Protein Description: Rho guanine nucleotide exchange factor (GEF) 19
Gene Name: ARHGEF19
Alternative Gene Name: FLJ33962, WGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028919: 95%, ENSRNOG00000047967: 95%
Entrez Gene ID: 128272
Uniprot ID: Q8IW93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSVAVGHFLGSAELSECLGAQDKQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDV
• Gene Sequence: LSVAVGHFLGSAELSECLGAQDKQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDV
• Gene ID - Mouse: ENSMUSG00000028919
• Gene ID - Rat: ENSRNOG00000047967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.