Protein Description: Rho GDP dissociation inhibitor gamma
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV |
| Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260) | |
| Datasheet | Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIG pAb (ATL-HPA078260) at Atlas |
| Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260) | |
| Datasheet | Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link) |
| Vendor Page | Anti ARHGDIG pAb (ATL-HPA078260) |