Anti ARHGDIG pAb (ATL-HPA078260)

Catalog No:
ATL-HPA078260-25
$447.00

Description

Product Description

Protein Description: Rho GDP dissociation inhibitor gamma
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
Gene Sequence DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
Gene ID - Mouse ENSMUSG00000073433
Gene ID - Rat ENSRNOG00000005809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260)
Datasheet Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link)
Vendor Page Anti ARHGDIG pAb (ATL-HPA078260) at Atlas Antibodies

Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260)
Datasheet Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link)
Vendor Page Anti ARHGDIG pAb (ATL-HPA078260)

Product Description

Protein Description: Rho GDP dissociation inhibitor gamma
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
Gene Sequence DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
Gene ID - Mouse ENSMUSG00000073433
Gene ID - Rat ENSRNOG00000005809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260)
Datasheet Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link)
Vendor Page Anti ARHGDIG pAb (ATL-HPA078260) at Atlas Antibodies

Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260)
Datasheet Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link)
Vendor Page Anti ARHGDIG pAb (ATL-HPA078260)