Description
Product Description
Protein Description: Rho GDP dissociation inhibitor gamma
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV |
Gene Sequence | DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV |
Gene ID - Mouse | ENSMUSG00000073433 |
Gene ID - Rat | ENSRNOG00000005809 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260) | |
Datasheet | Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link) |
Vendor Page | Anti ARHGDIG pAb (ATL-HPA078260) at Atlas Antibodies |
Documents & Links for Anti ARHGDIG pAb (ATL-HPA078260) | |
Datasheet | Anti ARHGDIG pAb (ATL-HPA078260) Datasheet (External Link) |
Vendor Page | Anti ARHGDIG pAb (ATL-HPA078260) |