Anti ARHGAP6 pAb (ATL-HPA064390)

Atlas Antibodies

Catalog No: ATL-HPA064390-25

• 

Product Description

Protein Description: Rho GTPase activating protein 6
Gene Name: ARHGAP6
Alternative Gene Name: rhoGAPX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031355: 84%, ENSRNOG00000021048: 28%
Entrez Gene ID: 395
Uniprot ID: O43182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS
• Gene Sequence: SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS
• Gene ID - Mouse: ENSMUSG00000031355
• Gene ID - Rat: ENSRNOG00000021048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.