Description
Product Description
Protein Description: Rho GTPase activating protein 6
Gene Name: ARHGAP6
Alternative Gene Name: rhoGAPX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031355: 84%, ENSRNOG00000021048: 28%
Entrez Gene ID: 395
Uniprot ID: O43182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP6
Alternative Gene Name: rhoGAPX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031355: 84%, ENSRNOG00000021048: 28%
Entrez Gene ID: 395
Uniprot ID: O43182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS |
Gene Sequence | SFHFDYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKS |
Gene ID - Mouse | ENSMUSG00000031355 |
Gene ID - Rat | ENSRNOG00000021048 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARHGAP6 pAb (ATL-HPA064390) | |
Datasheet | Anti ARHGAP6 pAb (ATL-HPA064390) Datasheet (External Link) |
Vendor Page | Anti ARHGAP6 pAb (ATL-HPA064390) at Atlas Antibodies |
Documents & Links for Anti ARHGAP6 pAb (ATL-HPA064390) | |
Datasheet | Anti ARHGAP6 pAb (ATL-HPA064390) Datasheet (External Link) |
Vendor Page | Anti ARHGAP6 pAb (ATL-HPA064390) |