Description
Product Description
Protein Description: Rho GTPase activating protein 45
Gene Name: ARHGAP45
Alternative Gene Name: HA-1, HMHA1, KIAA0223
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035697: 90%, ENSRNOG00000013220: 91%
Entrez Gene ID: 23526
Uniprot ID: Q92619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP45
Alternative Gene Name: HA-1, HMHA1, KIAA0223
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035697: 90%, ENSRNOG00000013220: 91%
Entrez Gene ID: 23526
Uniprot ID: Q92619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARK |
Gene Sequence | QELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARK |
Gene ID - Mouse | ENSMUSG00000035697 |
Gene ID - Rat | ENSRNOG00000013220 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) | |
Datasheet | Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) | |
Datasheet | Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARHGAP45 pAb (ATL-HPA079252 w/enhanced validation) |