Description
Product Description
Protein Description: Rho GTPase activating protein 36
Gene Name: ARHGAP36
Alternative Gene Name: FLJ30058
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036198: 79%, ENSRNOG00000007552: 75%
Entrez Gene ID: 158763
Uniprot ID: Q6ZRI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP36
Alternative Gene Name: FLJ30058
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036198: 79%, ENSRNOG00000007552: 75%
Entrez Gene ID: 158763
Uniprot ID: Q6ZRI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRR |
Gene Sequence | TAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRR |
Gene ID - Mouse | ENSMUSG00000036198 |
Gene ID - Rat | ENSRNOG00000007552 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARHGAP36 pAb (ATL-HPA076209) | |
Datasheet | Anti ARHGAP36 pAb (ATL-HPA076209) Datasheet (External Link) |
Vendor Page | Anti ARHGAP36 pAb (ATL-HPA076209) at Atlas Antibodies |
Documents & Links for Anti ARHGAP36 pAb (ATL-HPA076209) | |
Datasheet | Anti ARHGAP36 pAb (ATL-HPA076209) Datasheet (External Link) |
Vendor Page | Anti ARHGAP36 pAb (ATL-HPA076209) |