Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 88%, ENSRNOG00000025624: 88%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 88%, ENSRNOG00000025624: 88%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP |
Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303) | |
Datasheet | Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link) |
Vendor Page | Anti ARHGAP20 pAb (ATL-HPA076303) at Atlas |
Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303) | |
Datasheet | Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link) |
Vendor Page | Anti ARHGAP20 pAb (ATL-HPA076303) |