Anti ARHGAP20 pAb (ATL-HPA076303)

Catalog No:
ATL-HPA076303-25
$447.00

Description

Product Description

Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 88%, ENSRNOG00000025624: 88%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene Sequence STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene ID - Mouse ENSMUSG00000053199
Gene ID - Rat ENSRNOG00000025624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303) at Atlas Antibodies

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303)

Product Description

Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 88%, ENSRNOG00000025624: 88%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene Sequence STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene ID - Mouse ENSMUSG00000053199
Gene ID - Rat ENSRNOG00000025624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303) at Atlas Antibodies

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303)