Anti ARFIP2 pAb (ATL-HPA038156 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA038156-100

• 
• 
• 

Product Description

Protein Description: ADP-ribosylation factor interacting protein 2
Gene Name: ARFIP2
Alternative Gene Name: POR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030881: 98%, ENSRNOG00000018440: 98%
Entrez Gene ID: 23647
Uniprot ID: P53365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYG
• Gene Sequence: MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYG
• Gene ID - Mouse: ENSMUSG00000030881
• Gene ID - Rat: ENSRNOG00000018440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.