Protein Description: ADP-ribosylation factor interacting protein 1
Gene Name: ARFIP1
Alternative Gene Name: HSU52521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074513: 91%, ENSRNOG00000010533: 86%
Entrez Gene ID: 27236
Uniprot ID: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARFIP1
Alternative Gene Name: HSU52521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074513: 91%, ENSRNOG00000010533: 86%
Entrez Gene ID: 27236
Uniprot ID: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL |
| Documents & Links for Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) | |
| Datasheet | Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) at Atlas |
| Documents & Links for Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) | |
| Datasheet | Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) |