Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation)

Catalog No:
ATL-HPA063759-25
$447.00

Description

Product Description

Protein Description: ADP-ribosylation factor interacting protein 1
Gene Name: ARFIP1
Alternative Gene Name: HSU52521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074513: 91%, ENSRNOG00000010533: 86%
Entrez Gene ID: 27236
Uniprot ID: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
Gene Sequence MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
Gene ID - Mouse ENSMUSG00000074513
Gene ID - Rat ENSRNOG00000010533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation)
Datasheet Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation)

Product Description

Protein Description: ADP-ribosylation factor interacting protein 1
Gene Name: ARFIP1
Alternative Gene Name: HSU52521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074513: 91%, ENSRNOG00000010533: 86%
Entrez Gene ID: 27236
Uniprot ID: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
Gene Sequence MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
Gene ID - Mouse ENSMUSG00000074513
Gene ID - Rat ENSRNOG00000010533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation)
Datasheet Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARFIP1 pAb (ATL-HPA063759 w/enhanced validation)