Protein Description: A-Raf proto-oncogene, serine/threonine kinase
Gene Name: ARAF
Alternative Gene Name: ARAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001127: 83%, ENSRNOG00000010838: 81%
Entrez Gene ID: 369
Uniprot ID: P10398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARAF
Alternative Gene Name: ARAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001127: 83%, ENSRNOG00000010838: 81%
Entrez Gene ID: 369
Uniprot ID: P10398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTST |
| Documents & Links for Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) | |
| Datasheet | Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) at Atlas |
| Documents & Links for Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) | |
| Datasheet | Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARAF pAb (ATL-HPA066326 w/enhanced validation) |