Protein Description: androgen receptor
Gene Name: AR
Alternative Gene Name: AIS, DHTR, HUMARA, NR3C4, SBMA, SMAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046532: 83%, ENSRNOG00000005639: 83%
Entrez Gene ID: 367
Uniprot ID: P10275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AR
Alternative Gene Name: AIS, DHTR, HUMARA, NR3C4, SBMA, SMAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046532: 83%, ENSRNOG00000005639: 83%
Entrez Gene ID: 367
Uniprot ID: P10275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG |
Documents & Links for Anti AR pAb (ATL-HPA065701) | |
Datasheet | Anti AR pAb (ATL-HPA065701) Datasheet (External Link) |
Vendor Page | Anti AR pAb (ATL-HPA065701) at Atlas |
Documents & Links for Anti AR pAb (ATL-HPA065701) | |
Datasheet | Anti AR pAb (ATL-HPA065701) Datasheet (External Link) |
Vendor Page | Anti AR pAb (ATL-HPA065701) |