Protein Description: aquaporin 5
Gene Name: AQP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044217: 75%, ENSRNOG00000051970: 75%
Entrez Gene ID: 362
Uniprot ID: P55064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AQP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044217: 75%, ENSRNOG00000051970: 75%
Entrez Gene ID: 362
Uniprot ID: P55064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT |
| Documents & Links for Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) | |
| Datasheet | Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) at Atlas |
| Documents & Links for Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) | |
| Datasheet | Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) |
| Citations for Anti AQP5 pAb (ATL-HPA065008 w/enhanced validation) – 1 Found |
| Villandre, John; White, Virginia; Lear, Travis B; Chen, Yanwen; Tuncer, Ferhan; Vaiz, Emily; Tuncer, Beyza; Lockwood, Karina; Camarco, Dan; Liu, Yuan; Chen, Bill B; Evankovich, John. A Repurposed Drug Screen for Compounds Regulating Aquaporin 5 Stability in Lung Epithelial Cells. Frontiers In Pharmacology. 13( 35145418):828643. PubMed |