Protein Description: aprataxin
Gene Name: APTX
Alternative Gene Name: AOA, AOA1, AXA1, EAOH, EOAHA, FLJ20157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028411: 69%, ENSRNOG00000006582: 60%
Entrez Gene ID: 54840
Uniprot ID: Q7Z2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APTX
Alternative Gene Name: AOA, AOA1, AXA1, EAOH, EOAHA, FLJ20157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028411: 69%, ENSRNOG00000006582: 60%
Entrez Gene ID: 54840
Uniprot ID: Q7Z2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKD |
| Documents & Links for Anti APTX pAb (ATL-HPA064930) | |
| Datasheet | Anti APTX pAb (ATL-HPA064930) Datasheet (External Link) |
| Vendor Page | Anti APTX pAb (ATL-HPA064930) at Atlas |
| Documents & Links for Anti APTX pAb (ATL-HPA064930) | |
| Datasheet | Anti APTX pAb (ATL-HPA064930) Datasheet (External Link) |
| Vendor Page | Anti APTX pAb (ATL-HPA064930) |