Polyclonal Antibody against Human APPL2, Gene description: adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2, Alternative Gene Names: DIP13B, FLJ10659, Validated applications: ICC, Uniprot ID: Q8NEU8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications |
| Application |
ICC |
| Reactivity |
Human |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene Sequence |
ELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMA |
| Gene ID - Mouse |
ENSMUSG00000020263 |
| Gene ID - Rat |
ENSMUSG00000020263 |
| Buffer |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104744/184825/atl-hpa079223_anti-appl2-atl-hpa079223_68285__83266.1710523178.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104744/184825/atl-hpa079223_anti-appl2-atl-hpa079223_68285__83266.1710523178.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to vesicles.")