Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 94%, ENSRNOG00000013574: 95%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 94%, ENSRNOG00000013574: 95%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR |
| Documents & Links for Anti APPL1 pAb (ATL-HPA073477) | |
| Datasheet | Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link) |
| Vendor Page | Anti APPL1 pAb (ATL-HPA073477) at Atlas |
| Documents & Links for Anti APPL1 pAb (ATL-HPA073477) | |
| Datasheet | Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link) |
| Vendor Page | Anti APPL1 pAb (ATL-HPA073477) |