Anti APPL1 pAb (ATL-HPA073477)

Catalog No:
ATL-HPA073477-25
$395.00

Description

Product Description

Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 94%, ENSRNOG00000013574: 95%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
Gene Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
Gene ID - Mouse ENSMUSG00000040760
Gene ID - Rat ENSRNOG00000013574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti APPL1 pAb (ATL-HPA073477)
Datasheet Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA073477) at Atlas Antibodies

Documents & Links for Anti APPL1 pAb (ATL-HPA073477)
Datasheet Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA073477)

Product Description

Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 94%, ENSRNOG00000013574: 95%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
Gene Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
Gene ID - Mouse ENSMUSG00000040760
Gene ID - Rat ENSRNOG00000013574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti APPL1 pAb (ATL-HPA073477)
Datasheet Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA073477) at Atlas Antibodies

Documents & Links for Anti APPL1 pAb (ATL-HPA073477)
Datasheet Anti APPL1 pAb (ATL-HPA073477) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA073477)