Anti APPBP2 pAb (ATL-HPA078370)

Catalog No:
ATL-HPA078370-25
$447.00
Protein Description: amyloid beta precursor protein binding protein 2
Gene Name: APPBP2
Alternative Gene Name: Hs.84084, KIAA0228, PAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018481: 100%, ENSRNOG00000027654: 99%
Entrez Gene ID: 10513
Uniprot ID: Q92624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
Gene ID - Mouse ENSMUSG00000018481
Gene ID - Rat ENSMUSG00000018481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti APPBP2 pAb (ATL-HPA078370)
Datasheet Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link)
Vendor Page Anti APPBP2 pAb (ATL-HPA078370) at Atlas

Documents & Links for Anti APPBP2 pAb (ATL-HPA078370)
Datasheet Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link)
Vendor Page Anti APPBP2 pAb (ATL-HPA078370)