Protein Description: amyloid beta precursor protein binding protein 2
Gene Name: APPBP2
Alternative Gene Name: Hs.84084, KIAA0228, PAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018481: 100%, ENSRNOG00000027654: 99%
Entrez Gene ID: 10513
Uniprot ID: Q92624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APPBP2
Alternative Gene Name: Hs.84084, KIAA0228, PAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018481: 100%, ENSRNOG00000027654: 99%
Entrez Gene ID: 10513
Uniprot ID: Q92624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW |
Documents & Links for Anti APPBP2 pAb (ATL-HPA078370) | |
Datasheet | Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link) |
Vendor Page | Anti APPBP2 pAb (ATL-HPA078370) at Atlas |
Documents & Links for Anti APPBP2 pAb (ATL-HPA078370) | |
Datasheet | Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link) |
Vendor Page | Anti APPBP2 pAb (ATL-HPA078370) |