Protein Description: amyloid beta (A4) precursor protein
Gene Name: APP
Alternative Gene Name: AD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022892: 95%, ENSRNOG00000006997: 95%
Entrez Gene ID: 351
Uniprot ID: P05067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APP
Alternative Gene Name: AD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022892: 95%, ENSRNOG00000006997: 95%
Entrez Gene ID: 351
Uniprot ID: P05067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN |
Gene Sequence | ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN |
Gene ID - Mouse | ENSMUSG00000022892 |
Gene ID - Rat | ENSRNOG00000006997 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APP pAb (ATL-HPA001462 w/enhanced validation) | |
Datasheet | Anti APP pAb (ATL-HPA001462 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APP pAb (ATL-HPA001462 w/enhanced validation) at Atlas |
Documents & Links for Anti APP pAb (ATL-HPA001462 w/enhanced validation) | |
Datasheet | Anti APP pAb (ATL-HPA001462 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APP pAb (ATL-HPA001462 w/enhanced validation) |
Citations for Anti APP pAb (ATL-HPA001462 w/enhanced validation) – 2 Found |
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
Oi, Ryoko; Koizumi, Hirotaka; Maeda, Ichiro; Noguchi, Akira; Tatsunami, Shinobu; Iwatani, Tsuguo; Kawamoto, Hisanori; Tsugawa, Koichiro; Takagi, Masayuki. Clinicopathological Significance of TARBP2, APP, and ZNF395 in Breast Cancer. Breast Cancer : Basic And Clinical Research. 10( 27980417):211-221. PubMed |