Anti APOE pAb (ATL-HPA065539 w/enhanced validation)

Catalog No:
ATL-HPA065539-100
$429.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: apolipoprotein E
Gene Name: APOE
Alternative Gene Name: AD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002985: 70%, ENSRNOG00000018454: 74%
Entrez Gene ID: 348
Uniprot ID: P02649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW

Documents & Links for Anti APOE pAb (ATL-HPA065539 w/enhanced validation)
Datasheet Anti APOE pAb (ATL-HPA065539 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOE pAb (ATL-HPA065539 w/enhanced validation) at Atlas

Documents & Links for Anti APOE pAb (ATL-HPA065539 w/enhanced validation)
Datasheet Anti APOE pAb (ATL-HPA065539 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOE pAb (ATL-HPA065539 w/enhanced validation)

Citations for Anti APOE pAb (ATL-HPA065539 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed