Protein Description: apolipoprotein A2
Gene Name: APOA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005681: 63%, ENSRNOG00000003500: 63%
Entrez Gene ID: 336
Uniprot ID: P02652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APOA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005681: 63%, ENSRNOG00000003500: 63%
Entrez Gene ID: 336
Uniprot ID: P02652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSY |
| Documents & Links for Anti APOA2 pAb (ATL-HPA072575) | |
| Datasheet | Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link) |
| Vendor Page | Anti APOA2 pAb (ATL-HPA072575) at Atlas |
| Documents & Links for Anti APOA2 pAb (ATL-HPA072575) | |
| Datasheet | Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link) |
| Vendor Page | Anti APOA2 pAb (ATL-HPA072575) |