Protein Description: adipocyte plasma membrane associated protein
Gene Name: APMAP
Alternative Gene Name: BSCv, C20orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033096: 93%, ENSRNOG00000006795: 93%
Entrez Gene ID: 57136
Uniprot ID: Q9HDC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APMAP
Alternative Gene Name: BSCv, C20orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033096: 93%, ENSRNOG00000006795: 93%
Entrez Gene ID: 57136
Uniprot ID: Q9HDC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAE |
Documents & Links for Anti APMAP pAb (ATL-HPA064700) | |
Datasheet | Anti APMAP pAb (ATL-HPA064700) Datasheet (External Link) |
Vendor Page | Anti APMAP pAb (ATL-HPA064700) at Atlas |
Documents & Links for Anti APMAP pAb (ATL-HPA064700) | |
Datasheet | Anti APMAP pAb (ATL-HPA064700) Datasheet (External Link) |
Vendor Page | Anti APMAP pAb (ATL-HPA064700) |