Protein Description: adenomatosis polyposis coli down-regulated 1-like
Gene Name: APCDD1L
Alternative Gene Name: FLJ90166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071847: 55%, ENSRNOG00000043304: 56%
Entrez Gene ID: 164284
Uniprot ID: Q8NCL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APCDD1L
Alternative Gene Name: FLJ90166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071847: 55%, ENSRNOG00000043304: 56%
Entrez Gene ID: 164284
Uniprot ID: Q8NCL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QPTFTVYAAGRYTRGTPSTRVRGGTELVFEVTRAHVTPMDQVTTAMLNFSEPSSCGGAGAWSMGTERDVTATNGCLPLGIRLPHVEYEL |
| Documents & Links for Anti APCDD1L pAb (ATL-HPA067015) | |
| Datasheet | Anti APCDD1L pAb (ATL-HPA067015) Datasheet (External Link) |
| Vendor Page | Anti APCDD1L pAb (ATL-HPA067015) at Atlas |
| Documents & Links for Anti APCDD1L pAb (ATL-HPA067015) | |
| Datasheet | Anti APCDD1L pAb (ATL-HPA067015) Datasheet (External Link) |
| Vendor Page | Anti APCDD1L pAb (ATL-HPA067015) |