Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063903-25

• 
• 

Product Description

Protein Description: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
• Gene Sequence: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
• Gene ID - Mouse: ENSMUSG00000026786
• Gene ID - Rat: ENSRNOG00000017803
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.