Protein Description: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL |
Documents & Links for Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) | |
Datasheet | Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) at Atlas |
Documents & Links for Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) | |
Datasheet | Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) |