Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)

Catalog No:
ATL-HPA063903-25
$447.00

Description

Product Description

Protein Description: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Gene Sequence KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Gene ID - Mouse ENSMUSG00000026786
Gene ID - Rat ENSRNOG00000017803
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)
Datasheet Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)

Product Description

Protein Description: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Gene Sequence KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Gene ID - Mouse ENSMUSG00000026786
Gene ID - Rat ENSRNOG00000017803
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)
Datasheet Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APBB1IP pAb (ATL-HPA063903 w/enhanced validation)