Anti APBA1 pAb (ATL-HPA061287)

Atlas Antibodies

Catalog No: ATL-HPA061287-25

• 

Product Description

Protein Description: amyloid beta (A4) precursor protein-binding, family A, member 1
Gene Name: APBA1
Alternative Gene Name: D9S411E, MINT1, X11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024897: 95%, ENSRNOG00000014928: 95%
Entrez Gene ID: 320
Uniprot ID: Q02410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
• Gene Sequence: ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
• Gene ID - Mouse: ENSMUSG00000024897
• Gene ID - Rat: ENSRNOG00000014928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.