Anti AP5M1 pAb (ATL-HPA055768)

Atlas Antibodies

Catalog No: ATL-HPA055768-100

• 
• 

Product Description

Protein Description: adaptor-related protein complex 5, mu 1 subunit
Gene Name: AP5M1
Alternative Gene Name: C14orf108, FLJ10813, mu5, MuD, MUDENG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036291: 87%, ENSRNOG00000014148: 86%
Entrez Gene ID: 55745
Uniprot ID: Q9H0R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI
• Gene Sequence: PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI
• Gene ID - Mouse: ENSMUSG00000036291
• Gene ID - Rat: ENSRNOG00000014148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.