Protein Description: adaptor-related protein complex 5, beta 1 subunit
Gene Name: AP5B1
Alternative Gene Name: AP-5, DKFZp761E198, PP1030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049562: 74%, ENSRNOG00000026114: 79%
Entrez Gene ID: 91056
Uniprot ID: Q2VPB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP5B1
Alternative Gene Name: AP-5, DKFZp761E198, PP1030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049562: 74%, ENSRNOG00000026114: 79%
Entrez Gene ID: 91056
Uniprot ID: Q2VPB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL |
| Documents & Links for Anti AP5B1 pAb (ATL-HPA065739) | |
| Datasheet | Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link) |
| Vendor Page | Anti AP5B1 pAb (ATL-HPA065739) at Atlas |
| Documents & Links for Anti AP5B1 pAb (ATL-HPA065739) | |
| Datasheet | Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link) |
| Vendor Page | Anti AP5B1 pAb (ATL-HPA065739) |