Anti AP5B1 pAb (ATL-HPA065739)

Catalog No:
ATL-HPA065739-25
$303.00

Description

Product Description

Protein Description: adaptor-related protein complex 5, beta 1 subunit
Gene Name: AP5B1
Alternative Gene Name: AP-5, DKFZp761E198, PP1030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049562: 74%, ENSRNOG00000026114: 79%
Entrez Gene ID: 91056
Uniprot ID: Q2VPB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Gene Sequence HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Gene ID - Mouse ENSMUSG00000049562
Gene ID - Rat ENSRNOG00000026114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AP5B1 pAb (ATL-HPA065739)
Datasheet Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link)
Vendor Page Anti AP5B1 pAb (ATL-HPA065739) at Atlas Antibodies

Documents & Links for Anti AP5B1 pAb (ATL-HPA065739)
Datasheet Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link)
Vendor Page Anti AP5B1 pAb (ATL-HPA065739)

Product Description

Protein Description: adaptor-related protein complex 5, beta 1 subunit
Gene Name: AP5B1
Alternative Gene Name: AP-5, DKFZp761E198, PP1030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049562: 74%, ENSRNOG00000026114: 79%
Entrez Gene ID: 91056
Uniprot ID: Q2VPB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Gene Sequence HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Gene ID - Mouse ENSMUSG00000049562
Gene ID - Rat ENSRNOG00000026114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AP5B1 pAb (ATL-HPA065739)
Datasheet Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link)
Vendor Page Anti AP5B1 pAb (ATL-HPA065739) at Atlas Antibodies

Documents & Links for Anti AP5B1 pAb (ATL-HPA065739)
Datasheet Anti AP5B1 pAb (ATL-HPA065739) Datasheet (External Link)
Vendor Page Anti AP5B1 pAb (ATL-HPA065739)