Anti AP4M1 pAb (ATL-HPA066774)

Atlas Antibodies

Catalog No: ATL-HPA066774-25

• 

Product Description

Protein Description: adaptor-related protein complex 4, mu 1 subunit
Gene Name: AP4M1
Alternative Gene Name: MU-4, MU-ARP2, SPG50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019518: 97%, ENSRNOG00000001353: 96%
Entrez Gene ID: 9179
Uniprot ID: O00189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
• Gene Sequence: SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
• Gene ID - Mouse: ENSMUSG00000019518
• Gene ID - Rat: ENSRNOG00000001353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.