Protein Description: adaptor-related protein complex 4, mu 1 subunit
Gene Name: AP4M1
Alternative Gene Name: MU-4, MU-ARP2, SPG50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019518: 97%, ENSRNOG00000001353: 96%
Entrez Gene ID: 9179
Uniprot ID: O00189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP4M1
Alternative Gene Name: MU-4, MU-ARP2, SPG50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019518: 97%, ENSRNOG00000001353: 96%
Entrez Gene ID: 9179
Uniprot ID: O00189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES |
| Documents & Links for Anti AP4M1 pAb (ATL-HPA066774) | |
| Datasheet | Anti AP4M1 pAb (ATL-HPA066774) Datasheet (External Link) |
| Vendor Page | Anti AP4M1 pAb (ATL-HPA066774) at Atlas |
| Documents & Links for Anti AP4M1 pAb (ATL-HPA066774) | |
| Datasheet | Anti AP4M1 pAb (ATL-HPA066774) Datasheet (External Link) |
| Vendor Page | Anti AP4M1 pAb (ATL-HPA066774) |