Protein Description: adaptor-related protein complex 3, beta 1 subunit
Gene Name: AP3B1
Alternative Gene Name: ADTB3A, HPS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021686: 82%, ENSRNOG00000010624: 80%
Entrez Gene ID: 8546
Uniprot ID: O00203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP3B1
Alternative Gene Name: ADTB3A, HPS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021686: 82%, ENSRNOG00000010624: 80%
Entrez Gene ID: 8546
Uniprot ID: O00203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS |
| Gene Sequence | VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS |
| Gene ID - Mouse | ENSMUSG00000021686 |
| Gene ID - Rat | ENSRNOG00000010624 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AP3B1 pAb (ATL-HPA038737) | |
| Datasheet | Anti AP3B1 pAb (ATL-HPA038737) Datasheet (External Link) |
| Vendor Page | Anti AP3B1 pAb (ATL-HPA038737) at Atlas |
| Documents & Links for Anti AP3B1 pAb (ATL-HPA038737) | |
| Datasheet | Anti AP3B1 pAb (ATL-HPA038737) Datasheet (External Link) |
| Vendor Page | Anti AP3B1 pAb (ATL-HPA038737) |