Protein Description: adaptor-related protein complex 2, mu 1 subunit
Gene Name: AP2M1
Alternative Gene Name: AP50, CLAPM1, mu2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022841: 100%, ENSRNOG00000001709: 100%
Entrez Gene ID: 1173
Uniprot ID: Q96CW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP2M1
Alternative Gene Name: AP50, CLAPM1, mu2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022841: 100%, ENSRNOG00000001709: 100%
Entrez Gene ID: 1173
Uniprot ID: Q96CW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTF |
Documents & Links for Anti AP2M1 pAb (ATL-HPA069870) | |
Datasheet | Anti AP2M1 pAb (ATL-HPA069870) Datasheet (External Link) |
Vendor Page | Anti AP2M1 pAb (ATL-HPA069870) at Atlas |
Documents & Links for Anti AP2M1 pAb (ATL-HPA069870) | |
Datasheet | Anti AP2M1 pAb (ATL-HPA069870) Datasheet (External Link) |
Vendor Page | Anti AP2M1 pAb (ATL-HPA069870) |