Protein Description: adaptor related protein complex 2 beta 1 subunit
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 98%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 98%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL |
| Documents & Links for Anti AP2B1 pAb (ATL-HPA067983) | |
| Datasheet | Anti AP2B1 pAb (ATL-HPA067983) Datasheet (External Link) |
| Vendor Page | Anti AP2B1 pAb (ATL-HPA067983) at Atlas |
| Documents & Links for Anti AP2B1 pAb (ATL-HPA067983) | |
| Datasheet | Anti AP2B1 pAb (ATL-HPA067983) Datasheet (External Link) |
| Vendor Page | Anti AP2B1 pAb (ATL-HPA067983) |