Description
Product Description
Protein Description: adaptor-related protein complex 2, beta 1 subunit
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 100%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 100%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKA |
Gene Sequence | GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKA |
Gene ID - Mouse | ENSMUSG00000035152 |
Gene ID - Rat | ENSRNOG00000061543 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AP2B1 pAb (ATL-HPA056733) | |
Datasheet | Anti AP2B1 pAb (ATL-HPA056733) Datasheet (External Link) |
Vendor Page | Anti AP2B1 pAb (ATL-HPA056733) at Atlas Antibodies |
Documents & Links for Anti AP2B1 pAb (ATL-HPA056733) | |
Datasheet | Anti AP2B1 pAb (ATL-HPA056733) Datasheet (External Link) |
Vendor Page | Anti AP2B1 pAb (ATL-HPA056733) |