Protein Description: adaptor-related protein complex 1, sigma 3 subunit
Gene Name: AP1S3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054702: 86%, ENSRNOG00000049873: 89%
Entrez Gene ID: 130340
Uniprot ID: Q96PC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP1S3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054702: 86%, ENSRNOG00000049873: 89%
Entrez Gene ID: 130340
Uniprot ID: Q96PC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY |
| Documents & Links for Anti AP1S3 pAb (ATL-HPA066782) | |
| Datasheet | Anti AP1S3 pAb (ATL-HPA066782) Datasheet (External Link) |
| Vendor Page | Anti AP1S3 pAb (ATL-HPA066782) at Atlas |
| Documents & Links for Anti AP1S3 pAb (ATL-HPA066782) | |
| Datasheet | Anti AP1S3 pAb (ATL-HPA066782) Datasheet (External Link) |
| Vendor Page | Anti AP1S3 pAb (ATL-HPA066782) |