Description
Product Description
Protein Description: acyloxyacyl hydrolase (neutrophil)
Gene Name: AOAH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021322: 80%, ENSRNOG00000054964: 76%
Entrez Gene ID: 313
Uniprot ID: P28039
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AOAH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021322: 80%, ENSRNOG00000054964: 76%
Entrez Gene ID: 313
Uniprot ID: P28039
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNP |
Gene Sequence | QLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNP |
Gene ID - Mouse | ENSMUSG00000021322 |
Gene ID - Rat | ENSRNOG00000054964 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AOAH pAb (ATL-HPA021666) | |
Datasheet | Anti AOAH pAb (ATL-HPA021666) Datasheet (External Link) |
Vendor Page | Anti AOAH pAb (ATL-HPA021666) at Atlas Antibodies |
Documents & Links for Anti AOAH pAb (ATL-HPA021666) | |
Datasheet | Anti AOAH pAb (ATL-HPA021666) Datasheet (External Link) |
Vendor Page | Anti AOAH pAb (ATL-HPA021666) |