Protein Description: annexin A10
Gene Name: ANXA10
Alternative Gene Name: ANX14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031635: 84%, ENSRNOG00000014339: 79%
Entrez Gene ID: 11199
Uniprot ID: Q9UJ72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANXA10
Alternative Gene Name: ANX14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031635: 84%, ENSRNOG00000014339: 79%
Entrez Gene ID: 11199
Uniprot ID: Q9UJ72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDLREQLSDHFKDVMAG |
Documents & Links for Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) | |
Datasheet | Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) at Atlas |
Documents & Links for Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) | |
Datasheet | Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANXA10 pAb (ATL-HPA074650 w/enhanced validation) |