Description
Product Description
Protein Description: anoctamin 7
Gene Name: ANO7
Alternative Gene Name: IPCA-5, NGEP, PCANAP5, PCANAP5L, TMEM16G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034107: 62%, ENSRNOG00000023427: 60%
Entrez Gene ID: 50636
Uniprot ID: Q6IWH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANO7
Alternative Gene Name: IPCA-5, NGEP, PCANAP5, PCANAP5L, TMEM16G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034107: 62%, ENSRNOG00000023427: 60%
Entrez Gene ID: 50636
Uniprot ID: Q6IWH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLLVPDIPESVEIKVKREYYLAKQALAENEVLFGTNGTKDEQPEGSELSSHWTPFTVPKASQLQQ |
Gene Sequence | DLLVPDIPESVEIKVKREYYLAKQALAENEVLFGTNGTKDEQPEGSELSSHWTPFTVPKASQLQQ |
Gene ID - Mouse | ENSMUSG00000034107 |
Gene ID - Rat | ENSRNOG00000023427 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) | |
Datasheet | Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) | |
Datasheet | Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANO7 pAb (ATL-HPA078464 w/enhanced validation) |