Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061125-25

• 

Product Description

Protein Description: ankyrin repeat and sterile alpha motif domain containing 4B
Gene Name: ANKS4B
Alternative Gene Name: FLJ38819, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030909: 81%, ENSRNOG00000046181: 78%
Entrez Gene ID: 257629
Uniprot ID: Q8N8V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
• Gene Sequence: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
• Gene ID - Mouse: ENSMUSG00000030909
• Gene ID - Rat: ENSRNOG00000046181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.