Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)

Catalog No:
ATL-HPA061125-25
$447.00

Description

Product Description

Protein Description: ankyrin repeat and sterile alpha motif domain containing 4B
Gene Name: ANKS4B
Alternative Gene Name: FLJ38819, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030909: 81%, ENSRNOG00000046181: 78%
Entrez Gene ID: 257629
Uniprot ID: Q8N8V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
Gene Sequence TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
Gene ID - Mouse ENSMUSG00000030909
Gene ID - Rat ENSRNOG00000046181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)
Datasheet Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)

Product Description

Protein Description: ankyrin repeat and sterile alpha motif domain containing 4B
Gene Name: ANKS4B
Alternative Gene Name: FLJ38819, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030909: 81%, ENSRNOG00000046181: 78%
Entrez Gene ID: 257629
Uniprot ID: Q8N8V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
Gene Sequence TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG
Gene ID - Mouse ENSMUSG00000030909
Gene ID - Rat ENSRNOG00000046181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)
Datasheet Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)