Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)

Catalog No:
ATL-HPA065720-25
$447.00

Description

Product Description

Protein Description: ankyrin repeat domain 65
Gene Name: ANKRD65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078487: 57%, ENSRNOG00000043331: 51%
Entrez Gene ID: 441869
Uniprot ID: E5RJM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
Gene Sequence EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
Gene ID - Mouse ENSMUSG00000078487
Gene ID - Rat ENSRNOG00000043331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)
Datasheet Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)

Product Description

Protein Description: ankyrin repeat domain 65
Gene Name: ANKRD65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078487: 57%, ENSRNOG00000043331: 51%
Entrez Gene ID: 441869
Uniprot ID: E5RJM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
Gene Sequence EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
Gene ID - Mouse ENSMUSG00000078487
Gene ID - Rat ENSRNOG00000043331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)
Datasheet Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)