Description
Product Description
Protein Description: ankyrin repeat domain 65
Gene Name: ANKRD65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078487: 57%, ENSRNOG00000043331: 51%
Entrez Gene ID: 441869
Uniprot ID: E5RJM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKRD65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078487: 57%, ENSRNOG00000043331: 51%
Entrez Gene ID: 441869
Uniprot ID: E5RJM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH |
Gene Sequence | EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH |
Gene ID - Mouse | ENSMUSG00000078487 |
Gene ID - Rat | ENSRNOG00000043331 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) | |
Datasheet | Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) | |
Datasheet | Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation) |