Protein Description: ankyrin repeat domain 63
Gene Name: ANKRD63
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078137: 86%, ENSRNOG00000042446: 88%
Entrez Gene ID: 100131244
Uniprot ID: C9JTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKRD63
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078137: 86%, ENSRNOG00000042446: 88%
Entrez Gene ID: 100131244
Uniprot ID: C9JTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AGKNSGRHRAQGSERPELGRSMSLALGAVTEEEAARLRAGALMALPNSPQSSGTGRWRSQEVLEGAPPTLAQAPIGLSPHPEGGPGSGRLGLRRRSTAPD |
| Documents & Links for Anti ANKRD63 pAb (ATL-HPA066743) | |
| Datasheet | Anti ANKRD63 pAb (ATL-HPA066743) Datasheet (External Link) |
| Vendor Page | Anti ANKRD63 pAb (ATL-HPA066743) at Atlas |
| Documents & Links for Anti ANKRD63 pAb (ATL-HPA066743) | |
| Datasheet | Anti ANKRD63 pAb (ATL-HPA066743) Datasheet (External Link) |
| Vendor Page | Anti ANKRD63 pAb (ATL-HPA066743) |