Anti ANKRD6 pAb (ATL-HPA064642)

Atlas Antibodies

Catalog No: ATL-HPA064642-25

• 

Product Description

Protein Description: ankyrin repeat domain 6
Gene Name: ANKRD6
Alternative Gene Name: KIAA0957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040183: 87%, ENSRNOG00000007110: 85%
Entrez Gene ID: 22881
Uniprot ID: Q9Y2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDDRRRKSRPKVSAFSDPTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINKLE
• Gene Sequence: KDDRRRKSRPKVSAFSDPTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINKLE
• Gene ID - Mouse: ENSMUSG00000040183
• Gene ID - Rat: ENSRNOG00000007110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.