Protein Description: ankyrin repeat domain 6
Gene Name: ANKRD6
Alternative Gene Name: KIAA0957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040183: 87%, ENSRNOG00000007110: 85%
Entrez Gene ID: 22881
Uniprot ID: Q9Y2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKRD6
Alternative Gene Name: KIAA0957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040183: 87%, ENSRNOG00000007110: 85%
Entrez Gene ID: 22881
Uniprot ID: Q9Y2G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KDDRRRKSRPKVSAFSDPTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINKLE |
| Documents & Links for Anti ANKRD6 pAb (ATL-HPA064642) | |
| Datasheet | Anti ANKRD6 pAb (ATL-HPA064642) Datasheet (External Link) |
| Vendor Page | Anti ANKRD6 pAb (ATL-HPA064642) at Atlas |
| Documents & Links for Anti ANKRD6 pAb (ATL-HPA064642) | |
| Datasheet | Anti ANKRD6 pAb (ATL-HPA064642) Datasheet (External Link) |
| Vendor Page | Anti ANKRD6 pAb (ATL-HPA064642) |