Protein Description: ankyrin repeat domain 54
Gene Name: ANKRD54
Alternative Gene Name: LIAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033055: 74%, ENSRNOG00000010821: 61%
Entrez Gene ID: 129138
Uniprot ID: Q6NXT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKRD54
Alternative Gene Name: LIAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033055: 74%, ENSRNOG00000010821: 61%
Entrez Gene ID: 129138
Uniprot ID: Q6NXT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP |
| Documents & Links for Anti ANKRD54 pAb (ATL-HPA071287) | |
| Datasheet | Anti ANKRD54 pAb (ATL-HPA071287) Datasheet (External Link) |
| Vendor Page | Anti ANKRD54 pAb (ATL-HPA071287) at Atlas |
| Documents & Links for Anti ANKRD54 pAb (ATL-HPA071287) | |
| Datasheet | Anti ANKRD54 pAb (ATL-HPA071287) Datasheet (External Link) |
| Vendor Page | Anti ANKRD54 pAb (ATL-HPA071287) |