Anti ANKRD37 pAb (ATL-HPA058127)

Atlas Antibodies

Catalog No: ATL-HPA058127-25

• 

Product Description

Protein Description: ankyrin repeat domain 37
Gene Name: ANKRD37
Alternative Gene Name: Lrp2bp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050914: 91%, ENSRNOG00000031335: 94%
Entrez Gene ID: 353322
Uniprot ID: Q7Z713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV
• Gene Sequence: ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV
• Gene ID - Mouse: ENSMUSG00000050914
• Gene ID - Rat: ENSRNOG00000031335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.