Protein Description: ankyrin repeat and MYND domain containing 2
Gene Name: ANKMY2
Alternative Gene Name: DKFZP564O043, ZMYND20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036188: 93%, ENSRNOG00000005623: 95%
Entrez Gene ID: 57037
Uniprot ID: Q8IV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKMY2
Alternative Gene Name: DKFZP564O043, ZMYND20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036188: 93%, ENSRNOG00000005623: 95%
Entrez Gene ID: 57037
Uniprot ID: Q8IV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN |
| Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100) | |
| Datasheet | Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link) |
| Vendor Page | Anti ANKMY2 pAb (ATL-HPA067100) at Atlas |
| Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100) | |
| Datasheet | Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link) |
| Vendor Page | Anti ANKMY2 pAb (ATL-HPA067100) |
| Citations for Anti ANKMY2 pAb (ATL-HPA067100) – 1 Found |
| Somatilaka, Bandarigoda Nipunika; Hwang, Sun-Hee; Palicharla, Vivek Reddy; White, Kevin Andrew; Badgandi, Hemant; Shelton, John Michael; Mukhopadhyay, Saikat. Ankmy2 Prevents Smoothened-Independent Hyperactivation of the Hedgehog Pathway via Cilia-Regulated Adenylyl Cyclase Signaling. Developmental Cell. 2020;54(6):710-726.e8. PubMed |