Anti ANKMY2 pAb (ATL-HPA067100)

Catalog No:
ATL-HPA067100-25
$303.00

Description

Product Description

Protein Description: ankyrin repeat and MYND domain containing 2
Gene Name: ANKMY2
Alternative Gene Name: DKFZP564O043, ZMYND20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036188: 93%, ENSRNOG00000005623: 95%
Entrez Gene ID: 57037
Uniprot ID: Q8IV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN
Gene Sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN
Gene ID - Mouse ENSMUSG00000036188
Gene ID - Rat ENSRNOG00000005623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100)
Datasheet Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link)
Vendor Page Anti ANKMY2 pAb (ATL-HPA067100) at Atlas Antibodies

Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100)
Datasheet Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link)
Vendor Page Anti ANKMY2 pAb (ATL-HPA067100)

Citations

Citations for Anti ANKMY2 pAb (ATL-HPA067100) – 1 Found
Somatilaka, Bandarigoda Nipunika; Hwang, Sun-Hee; Palicharla, Vivek Reddy; White, Kevin Andrew; Badgandi, Hemant; Shelton, John Michael; Mukhopadhyay, Saikat. Ankmy2 Prevents Smoothened-Independent Hyperactivation of the Hedgehog Pathway via Cilia-Regulated Adenylyl Cyclase Signaling. Developmental Cell. 2020;54(6):710-726.e8.  PubMed

Product Description

Protein Description: ankyrin repeat and MYND domain containing 2
Gene Name: ANKMY2
Alternative Gene Name: DKFZP564O043, ZMYND20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036188: 93%, ENSRNOG00000005623: 95%
Entrez Gene ID: 57037
Uniprot ID: Q8IV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN
Gene Sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN
Gene ID - Mouse ENSMUSG00000036188
Gene ID - Rat ENSRNOG00000005623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100)
Datasheet Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link)
Vendor Page Anti ANKMY2 pAb (ATL-HPA067100) at Atlas Antibodies

Documents & Links for Anti ANKMY2 pAb (ATL-HPA067100)
Datasheet Anti ANKMY2 pAb (ATL-HPA067100) Datasheet (External Link)
Vendor Page Anti ANKMY2 pAb (ATL-HPA067100)

Citations

Citations for Anti ANKMY2 pAb (ATL-HPA067100) – 1 Found
Somatilaka, Bandarigoda Nipunika; Hwang, Sun-Hee; Palicharla, Vivek Reddy; White, Kevin Andrew; Badgandi, Hemant; Shelton, John Michael; Mukhopadhyay, Saikat. Ankmy2 Prevents Smoothened-Independent Hyperactivation of the Hedgehog Pathway via Cilia-Regulated Adenylyl Cyclase Signaling. Developmental Cell. 2020;54(6):710-726.e8.  PubMed