Description
Product Description
Protein Description: ankyrin repeat and LEM domain containing 1
Gene Name: ANKLE1
Alternative Gene Name: ANKRD41, FLJ39369, LEMD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046295: 57%, ENSRNOG00000017156: 59%
Entrez Gene ID: 126549
Uniprot ID: Q8NAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKLE1
Alternative Gene Name: ANKRD41, FLJ39369, LEMD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046295: 57%, ENSRNOG00000017156: 59%
Entrez Gene ID: 126549
Uniprot ID: Q8NAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADEDALAQQFEQPDP |
Gene Sequence | STVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADEDALAQQFEQPDP |
Gene ID - Mouse | ENSMUSG00000046295 |
Gene ID - Rat | ENSRNOG00000017156 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ANKLE1 pAb (ATL-HPA073498) | |
Datasheet | Anti ANKLE1 pAb (ATL-HPA073498) Datasheet (External Link) |
Vendor Page | Anti ANKLE1 pAb (ATL-HPA073498) at Atlas Antibodies |
Documents & Links for Anti ANKLE1 pAb (ATL-HPA073498) | |
Datasheet | Anti ANKLE1 pAb (ATL-HPA073498) Datasheet (External Link) |
Vendor Page | Anti ANKLE1 pAb (ATL-HPA073498) |
Citations
Citations for Anti ANKLE1 pAb (ATL-HPA073498) – 1 Found |
Bakshi, Divya; Katoch, Archana; Chakraborty, Souneek; Shah, Ruchi; Sharma, Bhanu; Bhat, Amrita; Verma, Sonali; Bhat, Gh Rasool; Nagpal, Ashna; Vaishnavi, Samantha; Goswami, Anindya; Kumar, Rakesh. ANKLE1 as New Hotspot Mutation for Breast Cancer in Indian Population and Has a Role in DNA Damage and Repair in Mammalian Cells. Frontiers In Genetics. 11( 33584808):609758. PubMed |