Anti AMOTL2 pAb (ATL-HPA063027)

Atlas Antibodies

Catalog No: ATL-HPA063027-25

• 

Product Description

Protein Description: angiomotin like 2
Gene Name: AMOTL2
Alternative Gene Name: LCCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032531: 84%, ENSRNOG00000008487: 82%
Entrez Gene ID: 51421
Uniprot ID: Q9Y2J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE
• Gene Sequence: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE
• Gene ID - Mouse: ENSMUSG00000032531
• Gene ID - Rat: ENSRNOG00000008487
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti AMOTL2 pAb (ATL-HPA063027) – 1 Found

Wang, Chao; Feng, Xu; Su, Dan; Chen, Zhen; Wang, Shimin; Tang, Mengfan; Huang, Min; Nie, Litong; Zhang, Huimin; Li, Siting; Yin, Ling; Johnson, Randy L; Hart, Traver; Chen, Junjie. Integrated screens uncover a cell surface tumor suppressor gene KIRREL involved in Hippo pathway. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(25):e2121779119.