Anti AMIGO2 pAb (ATL-HPA059601)

Atlas Antibodies

Catalog No: ATL-HPA059601-25

• 

Product Description

Protein Description: adhesion molecule with Ig-like domain 2
Gene Name: AMIGO2
Alternative Gene Name: ALI1, DEGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048218: 86%, ENSRNOG00000007032: 80%
Entrez Gene ID: 347902
Uniprot ID: Q86SJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
• Gene Sequence: CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
• Gene ID - Mouse: ENSMUSG00000048218
• Gene ID - Rat: ENSRNOG00000007032
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.