Description
Product Description
Protein Description: alpha-1-microglobulin/bikunin precursor
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN |
Gene Sequence | YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN |
Gene ID - Mouse | ENSMUSG00000028356 |
Gene ID - Rat | ENSRNOG00000006889 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AMBP pAb (ATL-HPA075585) | |
Datasheet | Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link) |
Vendor Page | Anti AMBP pAb (ATL-HPA075585) at Atlas Antibodies |
Documents & Links for Anti AMBP pAb (ATL-HPA075585) | |
Datasheet | Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link) |
Vendor Page | Anti AMBP pAb (ATL-HPA075585) |