![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101498/181618/atl-hpa075585_anti-ambp-pab-atl-hpa075585_63286__12556.1681137986.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: alpha-1-microglobulin/bikunin precursor
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN |
| Documents & Links for Anti AMBP pAb (ATL-HPA075585) | |
| Datasheet | Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link) |
| Vendor Page | Anti AMBP pAb (ATL-HPA075585) at Atlas |
| Documents & Links for Anti AMBP pAb (ATL-HPA075585) | |
| Datasheet | Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link) |
| Vendor Page | Anti AMBP pAb (ATL-HPA075585) |