Anti ALYREF pAb (ATL-HPA061282)

Atlas Antibodies

Catalog No: ATL-HPA061282-100

• 
• 

Product Description

Protein Description: Aly/REF export factor
Gene Name: ALYREF
Alternative Gene Name: ALY, ALY/REF, BEF, REF, THOC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025134: 100%, ENSRNOG00000036687: 100%
Entrez Gene ID: 10189
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET
• Gene Sequence: GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET
• Gene ID - Mouse: ENSMUSG00000025134
• Gene ID - Rat: ENSRNOG00000036687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.