Anti ALX4 pAb (ATL-HPA001903)

Atlas Antibodies

Catalog No: ATL-HPA001903-25

• 

Product Description

Protein Description: ALX homeobox 4
Gene Name: ALX4
Alternative Gene Name: FPP, KIAA1788, PFM, PFM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040310: 80%, ENSRNOG00000000008: 81%
Entrez Gene ID: 60529
Uniprot ID: Q9H161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQEGS
• Gene Sequence: SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQEGS
• Gene ID - Mouse: ENSMUSG00000040310
• Gene ID - Rat: ENSRNOG00000000008
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.